Главная страница arrow-right Базы данных arrow-right База данных свойств веществ (поиск)
Карта сайта

Свойства вещества:

α-бунгаротоксин

Тип вещества:

органическое

Брутто-формула (система Хилла):

C338H529N97O105S11

Молекулярная масса (в а.е.м.): 7984,115

        Летальная доза (ЛД50, в мг/кг):

        1,1 (, )
        0,15 (мыши, подкожно)

        Природные и антропогенные источники:

        Выделен из яда змеи Bungarus multicinctus.

        Информация из сети Интернет или других непостоянных источников:

        Продуцируется Bungarus multicinctus.

        Состоит из сигнального пептида (1-21) и собственно токсина (22-95). Первичная аминокислотная последовательность (95 аминокислотных остатков):

        10 20 30 40 50 60

        MKTLLLTLVV VTIVCLDLGY TIVCHTTATS PISAVTCPPG ENLCYRKMWC DAFCSSRGKV

        70 80 90

        VELGCAATCP SKKPYEEVTC CSTDKCNPHP KQRPG

        Имеет 5 дисульфидных связей: 24-44, 37-65, 50-54, 69-80, 81-86.

        [uniprot.org]

        Дополнительная информация:

        Полипептид из 74 аминокислот С 5 дисульфидными связями. Первичная аминокислотная последовательность (в однобуквенном коде):

        IVCHTTATIPSSAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNHPPKRQPG

        Источники информации:

        1. Journal of Toxicology - Toxin Reviews. - 2004. - Vol. 23, №1. - С. 49
        2. Rappuoli R., Montecucco C. Guidebook to protein toxins and their use in cell biology. - 1997. - С. 192-193
        3. Досон Р., Эллиот Д., Эллиот У., Джонс К. Справочник биохимика. - М.: Мир, 1991. - С. 243
        4. Орлов Б.Н., Гелашвили Д.Б. Зоотоксинология: ядовитые животные и их яды. - М.: Высшая школа, 1985. - С. 219, 224-225


        Если не нашли нужное вещество или свойства можно выполнить следующие действия:
        Если вы нашли ошибку на странице, выделите ее и нажмите Ctrl + Enter.



        © Сбор и оформление информации: Руслан Анатольевич Кипер